HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6C7I810",
"id": "A0A6C7I810_SALTD",
"source_organism": {
"taxId": "568708",
"scientificName": "Salmonella typhimurium (strain D23580)",
"fullName": "Salmonella typhimurium (strain D23580)"
},
"name": "FAD-binding domain-containing protein",
"description": null,
"length": 391,
"sequence": "MTNQPTEIAIVGGGMVGGALALGLAQQGFTVMVIEHAAPAPFVADSQPDVRISAISAASVALLKGLGVWEAVQGMRSHPYRRLETWEWENAHVVFDAAELKLPLLGYMVENNVLQQALWQALEAHPGVTLRVPASLAALQRRHDGYALELADGECITPKLVIGADGANSQVRQMAGIGIHAWQYAQSCMLITVKCENAPGDSTWQQFTPTGPRAFLPLFDDWASLVWYDAPARIRQLQGLSMTQLQVEINQHFPARLGAVMPVAAGAFPLTRRHALQYAQPGLALVGDAAHTIHPLAGQGVNLGYRDVDALIDVLASARSYGESWASHSVLKRYQTRRMADNFMMQSGMDLFYAGFSNELPPLRILRNMGLMAAQRAGVLKRQALKYALGL",
"proteome": null,
"gene": "STMMW_07361",
"go_terms": [
{
"identifier": "GO:0071949",
"name": "FAD binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016705",
"name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050660",
"name": "flavin adenine dinucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006744",
"name": "ubiquinone biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9c7f5296d6644f33c90c2db6a0e818242dc1e0d0",
"counters": {
"domain_architectures": 159379,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"ncbifam": 2,
"prints": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 159379
}
}
}