GET /api/protein/UniProt/A0A6C7AJ05/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6C7AJ05",
        "id": "A0A6C7AJ05_SALTU",
        "source_organism": {
            "taxId": "990282",
            "scientificName": "Salmonella typhimurium (strain ATCC 68169 / UK-1)",
            "fullName": "Salmonella typhimurium (strain ATCC 68169 / UK-1)"
        },
        "name": "tRNA-specific 2-thiouridylase MnmA",
        "description": [
            "Catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA(Lys), tRNA(Glu) and tRNA(Gln), leading to the formation of s(2)U34, the first step of tRNA-mnm(5)s(2)U34 synthesis. Sulfur is provided by IscS, via a sulfur-relay system. Binds ATP and its substrate tRNAs"
        ],
        "length": 383,
        "sequence": "MIEYAALKFNVASIPMSESPKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVNGKSRLLRGLDGNKDQSYFLYTLGHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFRDFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKDGSEDPWYVVDKDVENNVLIVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTLRCTVKTRYRQTDIPCTINALNDDRIEVIFDEPVAAVTPGQSAVFYSGEVCLGGGIIEQRLPLTV",
        "proteome": null,
        "gene": "mnmA",
        "go_terms": [
            {
                "identifier": "GO:0016740",
                "name": "transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008033",
                "name": "tRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016783",
                "name": "sulfurtransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "eea6bd6f05413ed5899e6ed945f81f92c19b1a59",
        "counters": {
            "domain_architectures": 28892,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 1,
                "pfam": 3,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 2,
                "hamap": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 28892
        }
    }
}