GET /api/protein/UniProt/A0A6C1DW33/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6C1DW33",
"id": "A0A6C1DW33_SACPS",
"source_organism": {
"taxId": "27292",
"scientificName": "Saccharomyces pastorianus",
"fullName": "Saccharomyces pastorianus (Lager yeast)"
},
"name": "Ribosome assembly factor mrt4",
"description": [
"Component of the ribosome assembly machinery. Nuclear paralog of the ribosomal protein P0, it binds pre-60S subunits at an early stage of assembly in the nucleolus, and is replaced by P0 in cytoplasmic pre-60S subunits and mature 80S ribosomes"
],
"length": 236,
"sequence": "MPRSKRSKLVTLAQTDKKGRENKERIFDEVREALDTYRYVWVLHLDDVRTPVLQEIRTSWAGSKLIMGKRKVLQKALGEKREEEYKENLYQLSKLCSGVTGLLFTDEDVNTVKEYFKSYVRSDYSRPNTKAPLTFTIPEGIVYSRGGQIPAEEDVPMIHSLEPTMRNKFEIPTKIKAGKITIDSPYLVCTEGEKLDVRQALILKQFGIAASEFKVKVSAYYDNDSSTVESTNINME",
"proteome": "UP000501346",
"gene": "MRT4_1",
"go_terms": [
{
"identifier": "GO:0000027",
"name": "ribosomal large subunit assembly",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c6aebf5278acac33a60101385747d8081782d964",
"counters": {
"domain_architectures": 5943,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cdd": 1,
"cathgene3d": 2,
"pfam": 2,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5943
}
}
}