GET /api/protein/UniProt/A0A6B9FIM0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6B9FIM0",
"id": "A0A6B9FIM0_9HYPH",
"source_organism": {
"taxId": "908290",
"scientificName": "Methylobacterium mesophilicum SR1.6/6",
"fullName": "Methylobacterium mesophilicum SR1.6/6"
},
"name": "Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE",
"description": [
"Methyltransferase required for the conversion of demethylmenaquinol (DMKH2) to menaquinol (MKH2) and the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2)"
],
"length": 261,
"sequence": "MKAGDGASERASADFGFERVALDEKQGRVDSVFHSVARRYDIMNDLMSAGLHRAWKAQLVSMLRPPQNRAFAHLDVAGGTGDVAFRVLAAGGPRTRVTVLDINESMLRVGAERARDRKIDEVGDRIAFVTGNAEALPLPDAAFDAYTIAFGIRNVPRIDAALAEARRVLKPGGRFLCLEFSAVDVPLLDRIYDAYSFNVIPRIGARVAGDAESYRYLVESIRKFPTRGAFAGMIERAGFRHVTDRPLSGGIVAIHSGWKVT",
"proteome": null,
"gene": "ubiE",
"go_terms": [
{
"identifier": "GO:0008168",
"name": "methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5ac5548d5e504575f3d15712f6008650ab117a55",
"counters": {
"domain_architectures": 29373,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"profile": 1,
"cathgene3d": 1,
"cdd": 1,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"pfam": 1,
"prosite": 2,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 29373
}
}
}