General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6B9DD97",
        "id": "A0A6B9DD97_AVIMR",
        "source_organism": {
            "taxId": "82927",
            "scientificName": "Avicennia marina",
            "fullName": "Avicennia marina (Grey mangrove)"
        },
        "name": "NADH-quinone oxidoreductase subunit A",
        "description": [
            "Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone",
            "NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient"
        ],
        "length": 120,
        "sequence": "MFLLYEYDIFWAFLIISSLIPILAFLISGILAPIRKGPEKLSTYESGIEPMGDAWLQFRIRYYMFALVFVVFDVETVFLYPWAMSFDILGVSVFIEAFIFVLILIVGLVYAWRKGALEWS",
        "proteome": null,
        "gene": "ndhC",
        "go_terms": [
            {
                "identifier": "GO:0016651",
                "name": "oxidoreductase activity, acting on NAD(P)H",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008137",
                "name": "NADH dehydrogenase (ubiquinone) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e9a5b42e32de65bd6bc464b4186c01128f5abeb7",
        "counters": {
            "domain_architectures": 65483,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 65483
        }
    }
}