HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6B3LIZ6",
"id": "A0A6B3LIZ6_9BACT",
"source_organism": {
"taxId": "2704466",
"scientificName": "Pontibacter burrus",
"fullName": "Pontibacter burrus"
},
"name": "UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase",
"description": [
"Involved in cell wall formation. Catalyzes the final step in the synthesis of UDP-N-acetylmuramoyl-pentapeptide, the precursor of murein"
],
"length": 428,
"sequence": "MQISIEFLYQKYLECRHVSTDSRAEQDQSLFFALNGPNFKGAKFATTALEKGAKYAVVDDPAMAADNVFVVEDTLQTLQDLARHHRRTLSIPVIGITGSNGKTTTKELIYTVLSQKFNTLYTQGNLNNHIGVPLTLLRIKPEHEMAIIEMGANHIGEIELLCTIALPTHGMITNIGKAHLEGFGSLEGVARGKSELYVHLDKTAGTVFVNTGNDHLMRMSRRIADKITYPATEDFYHSELLEASPYVVYKDEEDNVVHTQLVGSYNYENMAAAACIGKYFGVPLSKANEAIANYSPVNNRSQVLQKGSNTIILDAYNANPTSMAAAIRNFGSMNAPRKVVILGDMFEMGNESITEHTALGTIAAEQPFDMVLLCGKDMQYAAKANPYFKHFETKQELQNWLQQNTISESYILIKGSRGMGLETLVELL",
"proteome": "UP000474777",
"gene": "murF",
"go_terms": [
{
"identifier": "GO:0016881",
"name": "acid-amino acid ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009058",
"name": "biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0047480",
"name": "UDP-N-acetylmuramoyl-tripeptide-D-alanyl-D-alanine ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0071555",
"name": "cell wall organization",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "617c8cb3e9dfe470c831f3c70f49056f5e477a85",
"counters": {
"domain_architectures": 78555,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 3,
"pfam": 3,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 78555
}
}
}