General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6A5F5N6",
        "id": "A0A6A5F5N6_PERFL",
        "source_organism": {
            "taxId": "8168",
            "scientificName": "Perca fluviatilis",
            "fullName": "Perca fluviatilis (European perch)"
        },
        "name": "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13",
        "description": [
            "Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Involved in the interferon/all-trans-retinoic acid (IFN/RA) induced cell death. This apoptotic activity is inhibited by interaction with viral IRF1. Prevents the transactivation of STAT3 target genes. May play a role in CARD15-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes",
            "Complex I functions in the transfer of electrons from NADH to the respiratory chain. Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis"
        ],
        "length": 144,
        "sequence": "MAGSKVKQDMPPPGGYAPFDYKRNLPKRGLSGYSMFGIGIGIMVFGYWRLFSWNRERRRLQIEEMEARIALMPLLQAEQDRRSLRMLRENLEEEAILMKDVPGWKVGEKVFHTDRWVPPLSEELFNLRPREQLLHKRFGFLWYV",
        "proteome": "UP000465112",
        "gene": "PFLUV_G00137190",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "10065c12fdcb9abecbc1f04adc54a4d52c5223b9",
        "counters": {
            "domain_architectures": 3729,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3729
        }
    }
}