GET /api/protein/UniProt/A0A678T5S1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A678T5S1",
        "id": "A0A678T5S1_CARGB",
        "source_organism": {
            "taxId": "101364",
            "scientificName": "Carassius gibelio",
            "fullName": "Carassius gibelio (Prussian carp)"
        },
        "name": "Solute carrier family 15 member 1",
        "description": [
            "Electrogenic proton-coupled amino-acid transporter that transports oligopeptides of 2 to 4 amino acids with a preference for dipeptides. Transports neutral and monovalently charged peptides with a proton to peptide stoichiometry of 1:1 or 2:1. Primarily responsible for the absorption of dietary di- and tripeptides from the small intestinal lumen. Mediates transepithelial transport of muramyl and N-formylated bacterial dipeptides contributing to recognition of pathogenic bacteria by the mucosal immune system"
        ],
        "length": 585,
        "sequence": "MAISAIHDITDTDKDGTPDNMTFHTAMSMLGLILIALGTGGIKPCVAAFGGDQFEEHQEKQRSTFFSIFYLSINAGSLLSTLITPILRAQECGIYSKQSCFPLAFGVPAALMVVALIVFIAGHGMYIMESPKGNILLQVMNCIGFAVSNRFNHRGKQYPKREHWMDWAEEKYDKLLIAQVKMVLKVLFLYIPLPMFWALFDQQGSRWTLQATTMDGNFGAFIIQPDQMQIVNPILIVIMVPIMDSAVYPLIKKCGLNFTPLRRMTVGMVLAALAFVAAALLQIQIDQTVPDFPSNSQTQVKFLNLEETSVPVIVDGQEPFVVPGFDSSNDYMTLDKMVVMVSAGGRNATAFFVRGKRQTVLMNANGILRILNDITEKPNQGMNAIRFVNGLRSPLNFSIKSDHLGSITYLQASDYLIVTHGKANFSIVNQEGQTCHYILQLGFGSSYTVLIPSNFTFGESCTENIKAIEDIEPNGIHMAWQIIQYFLITCGEVVFSVTGLDFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAEAGSLPDQWAEYVLFACLLVAVSIIFAVMAYFYTYIDPAEIEAKFMELKPE",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0022857",
                "name": "transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0006857",
                "name": "oligopeptide transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "03980fe80fd29f5043b13de7a766dbc1745073d3",
        "counters": {
            "domain_architectures": 12048,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 12048
        }
    }
}