HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A678T5S1",
"id": "A0A678T5S1_CARGB",
"source_organism": {
"taxId": "101364",
"scientificName": "Carassius gibelio",
"fullName": "Carassius gibelio (Prussian carp)"
},
"name": "Solute carrier family 15 member 1",
"description": [
"Electrogenic proton-coupled amino-acid transporter that transports oligopeptides of 2 to 4 amino acids with a preference for dipeptides. Transports neutral and monovalently charged peptides with a proton to peptide stoichiometry of 1:1 or 2:1. Primarily responsible for the absorption of dietary di- and tripeptides from the small intestinal lumen. Mediates transepithelial transport of muramyl and N-formylated bacterial dipeptides contributing to recognition of pathogenic bacteria by the mucosal immune system"
],
"length": 585,
"sequence": "MAISAIHDITDTDKDGTPDNMTFHTAMSMLGLILIALGTGGIKPCVAAFGGDQFEEHQEKQRSTFFSIFYLSINAGSLLSTLITPILRAQECGIYSKQSCFPLAFGVPAALMVVALIVFIAGHGMYIMESPKGNILLQVMNCIGFAVSNRFNHRGKQYPKREHWMDWAEEKYDKLLIAQVKMVLKVLFLYIPLPMFWALFDQQGSRWTLQATTMDGNFGAFIIQPDQMQIVNPILIVIMVPIMDSAVYPLIKKCGLNFTPLRRMTVGMVLAALAFVAAALLQIQIDQTVPDFPSNSQTQVKFLNLEETSVPVIVDGQEPFVVPGFDSSNDYMTLDKMVVMVSAGGRNATAFFVRGKRQTVLMNANGILRILNDITEKPNQGMNAIRFVNGLRSPLNFSIKSDHLGSITYLQASDYLIVTHGKANFSIVNQEGQTCHYILQLGFGSSYTVLIPSNFTFGESCTENIKAIEDIEPNGIHMAWQIIQYFLITCGEVVFSVTGLDFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAEAGSLPDQWAEYVLFACLLVAVSIIFAVMAYFYTYIDPAEIEAKFMELKPE",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0022857",
"name": "transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0006857",
"name": "oligopeptide transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "03980fe80fd29f5043b13de7a766dbc1745073d3",
"counters": {
"domain_architectures": 12048,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 12048
}
}
}