GET /api/protein/UniProt/A0A674P6V5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A674P6V5",
        "id": "A0A674P6V5_TAKRU",
        "source_organism": {
            "taxId": "31033",
            "scientificName": "Takifugu rubripes",
            "fullName": "Takifugu rubripes (Japanese pufferfish)"
        },
        "name": "CCR4-NOT transcription complex subunit 4",
        "description": [
            "Has E3 ubiquitin ligase activity, promoting ubiquitination and degradation of target proteins. Involved in activation of the JAK/STAT pathway. Catalyzes ubiquitination of methylated RBM15. Plays a role in quality control of translation of mitochondrial outer membrane-localized mRNA. As part of the PINK1-regulated signaling, upon mitochondria damage, ubiquitinates ABCE1 and thereby recruits autophagy receptors to the mitochondrial outer membrane to initiate mitophagy"
        ],
        "length": 814,
        "sequence": "MSHSPEMKDDPMECPLCMEPLEIDDVNFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEDIQRIKNEKKQKQNEKKQKVTENRKHLASVRVVQRNLVFVVGLSQRLADPEVLKRPEYFGRFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKSMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQDLYKINPSFLQPPACGTEKTKNKTNSTQRSNSSNGKDGWPTLLGHGKLANGLSEDRKSPPLLDYLDQDVLTSDEAELGPNQCTALSPFSSNCDSNSPSDKPPESIGMVNGETLKQVNIWGCLLSVCPEVVFKTFSLFQLPPSDSPSPPPGLTKPSLVVPVSVSDLTARSPFEGAAAESQSLFSDNSNFRHPNPLPAGLPPFPASPRSNSDWPMTPEPQSLFTSETIPVSSSTDWQAAFGFGSSSKQQDDDLGFDPFDVTRKALADLIEKELSVQDQSPSSPGPFGQGGGLPPLPNASASHHFPSSLPRLPQLHHRPVYSSFSFPNSQNSKASQQQAATRHPWMGVPTRHNLAHLNHSAGAVSHSNFLDLNLPPQHNTGLGGIPISENSGSIDGLNVKEWQDGLRALLPNININFGGLPNSSSSSSSSSSNSVNHIGGPTGPTGISHSLSWESAASWMDPAIITGIPAAAGNSLDSLQDDNPPHWLKSLQALTEMDGPAGSAVPTPQSLHTGLLDAHLPLHHRAAGGWAPYLAPPTANPASQFHAPPPGFQTAFRPPGQPTTELLQSAAVDRH",
        "proteome": "UP000005226",
        "gene": "cnot4a",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004842",
                "name": "ubiquitin-protein transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030014",
                "name": "CCR4-NOT complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b80063a825e18f76bedddaef7378af223444bbe2",
        "counters": {
            "domain_architectures": 4965,
            "entries": 23,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "cdd": 2,
                "profile": 3,
                "pfam": 2,
                "smart": 1,
                "panther": 1,
                "interpro": 10
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4965
        }
    }
}