GET /api/protein/UniProt/A0A673KN73/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A673KN73",
        "id": "A0A673KN73_9TELE",
        "source_organism": {
            "taxId": "307959",
            "scientificName": "Sinocyclocheilus rhinocerous",
            "fullName": "Sinocyclocheilus rhinocerous"
        },
        "name": "alcohol dehydrogenase (NADP(+))",
        "description": [
            "Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols. Displays enzymatic activity towards endogenous metabolites such as aromatic and aliphatic aldehydes, ketones, monosaccharides and bile acids. Acts as an aldehyde-detoxification enzyme. Also acts as an inhibitor of protein S-nitrosylation by mediating degradation of S-nitroso-coenzyme A (S-nitroso-CoA), a cofactor required to S-nitrosylate proteins. Also acts as a S-nitroso-glutathione reductase by catalyzing the NADPH-dependent reduction of S-nitrosoglutathione. Displays no reductase activity towards retinoids"
        ],
        "length": 329,
        "sequence": "KQCVYFSTITLSTGQQMPAVGLGTWKSAQGQVKQAVLAALDCDYRHIDCAAAYSNEREVGEALSERLGEGKPLRREDIFVTSKLWNTKHHPDDVEDACKKSLSDLRLSYLDLYLMHWPMAFERGDELMPRRLDGTVRYDNNTHYRDTWAAMEKLVDQGLVKAIGLSNFNARQIDDILSIAKHKPVVNQVECHPYLVQTQLVSQCWGRGLAVTAYSPLGSPDRPWVTPGEAHLLDDPRVVGLATCYNKTPAQVIIRWHIQRGVICIPKSVTPSRIKQNIEVFDFKLTDEDMRVIESFNRNERLIIPTIMIDGQKVWRDAKHPHFPFSDPC",
        "proteome": "UP000472270",
        "gene": "akr1a1a",
        "go_terms": [
            {
                "identifier": "GO:0008106",
                "name": "alcohol dehydrogenase (NADP+) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046185",
                "name": "aldehyde catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e96b765c85e65c75beacfc1efe2818f689e0515d",
        "counters": {
            "domain_architectures": 291149,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 291149
        }
    }
}