HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A673KN73",
"id": "A0A673KN73_9TELE",
"source_organism": {
"taxId": "307959",
"scientificName": "Sinocyclocheilus rhinocerous",
"fullName": "Sinocyclocheilus rhinocerous"
},
"name": "alcohol dehydrogenase (NADP(+))",
"description": [
"Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols. Displays enzymatic activity towards endogenous metabolites such as aromatic and aliphatic aldehydes, ketones, monosaccharides and bile acids. Acts as an aldehyde-detoxification enzyme. Also acts as an inhibitor of protein S-nitrosylation by mediating degradation of S-nitroso-coenzyme A (S-nitroso-CoA), a cofactor required to S-nitrosylate proteins. Also acts as a S-nitroso-glutathione reductase by catalyzing the NADPH-dependent reduction of S-nitrosoglutathione. Displays no reductase activity towards retinoids"
],
"length": 329,
"sequence": "KQCVYFSTITLSTGQQMPAVGLGTWKSAQGQVKQAVLAALDCDYRHIDCAAAYSNEREVGEALSERLGEGKPLRREDIFVTSKLWNTKHHPDDVEDACKKSLSDLRLSYLDLYLMHWPMAFERGDELMPRRLDGTVRYDNNTHYRDTWAAMEKLVDQGLVKAIGLSNFNARQIDDILSIAKHKPVVNQVECHPYLVQTQLVSQCWGRGLAVTAYSPLGSPDRPWVTPGEAHLLDDPRVVGLATCYNKTPAQVIIRWHIQRGVICIPKSVTPSRIKQNIEVFDFKLTDEDMRVIESFNRNERLIIPTIMIDGQKVWRDAKHPHFPFSDPC",
"proteome": "UP000472270",
"gene": "akr1a1a",
"go_terms": [
{
"identifier": "GO:0008106",
"name": "alcohol dehydrogenase (NADP+) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046185",
"name": "aldehyde catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e96b765c85e65c75beacfc1efe2818f689e0515d",
"counters": {
"domain_architectures": 291149,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"pirsf": 1,
"panther": 1,
"prints": 1,
"prosite": 2,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 291149
}
}
}