General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A673K5R7",
        "id": "A0A673K5R7_9TELE",
        "source_organism": {
            "taxId": "307959",
            "scientificName": "Sinocyclocheilus rhinocerous",
            "fullName": "Sinocyclocheilus rhinocerous"
        },
        "name": "E-selectin",
        "description": [
            "Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with SELPLG/PSGL1. May have a role in capillary morphogenesis"
        ],
        "length": 418,
        "sequence": "LISSGKKANHTSTEGWSYHYSTITMNWESARHWCRQHYTDMVAIQNKDEIYHLNSILPKVNGYYWIGIRKINGIWTWVGTNKMLTKEAENWADMEPNNGRNNEDCVEIYIKRVPDEGKWNDESCLKKKTALCYTASCKDDSCVSGQGKCVETINSHKCSCFGGFYGDRCEHVVKCKPEDITPLDHAIIQCSHPHEDFSYDSQCEYFCEEGYELIGSRTTRCTSTTEWSSKPPTCELIHCPALDSPVNGELSCTSSFNYGSKCSFSCVEGFRLQGASEISCTKTAKWSQEPPRCEGNQQPFATFMDLQVNLMLVFVFQKITMVCPQLPEPINGHMNCSSEEPTFGTICIFSCHEGHQLEDHSNEMVMCNYNGSWSGELAVCQEVTLGVAAAISGSSLGLVLWILKRLRRKGEPNSLLSL",
        "proteome": "UP000472270",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0007155",
                "name": "cell adhesion",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2f521971cb762ce29fdade8c8b60579c50dfc481",
        "counters": {
            "domain_architectures": 73,
            "entries": 30,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 5,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 2,
                "profile": 3,
                "ssf": 3,
                "cdd": 3,
                "cathgene3d": 2,
                "pfam": 2,
                "panther": 1,
                "prosite": 3,
                "prints": 1,
                "interpro": 10
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 73
        }
    }
}