General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A673HYQ5",
        "id": "A0A673HYQ5_9TELE",
        "source_organism": {
            "taxId": "307959",
            "scientificName": "Sinocyclocheilus rhinocerous",
            "fullName": "Sinocyclocheilus rhinocerous"
        },
        "name": "Suppressor of cytokine signaling 3",
        "description": [
            "SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including IL6ST/gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity and regulates IL6 signaling. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins"
        ],
        "length": 219,
        "sequence": "MVTHSRFDSAMSSSPFEGGVRLPPHRYKTFSSRAQYQMVIVAVRKLQESGFYWSTVSGKEASALLNAEPPGTFLVRDSSDHHHFFTLSVKTTTGTKNLRIQCDSVSFFLQTDPRSEQAVPRFDCVLKLIHHYMPSPGTGTSSKVQAVGEGGSVADGSAYYIYSGGEKIPLELLRPLASSMSSLQHLCRKTLNGHIDVSTKRDQLPHPLQEFLQEYDAPI",
        "proteome": "UP000472270",
        "gene": "LOC107722230",
        "go_terms": [
            {
                "identifier": "GO:0035556",
                "name": "intracellular signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8797a2809872b61a223c5f69e3b5d4c1858c033a",
        "counters": {
            "domain_architectures": 22787,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 1,
                "smart": 3,
                "pfam": 1,
                "profile": 2,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22787
        }
    }
}