GET /api/protein/UniProt/A0A672IMP5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A672IMP5",
"id": "A0A672IMP5_SALFA",
"source_organism": {
"taxId": "181472",
"scientificName": "Salarias fasciatus",
"fullName": "Salarias fasciatus (Jewelled blenny)"
},
"name": "Neuromodulin",
"description": [
"This protein is associated with nerve growth. It is a major component of the motile 'growth cones' that form the tips of elongating axons. Plays a role in axonal and dendritic filopodia induction"
],
"length": 242,
"sequence": "MLCCIRRTKPVEKNEEADQKIEQDGTTNKPEDKAHKAATKIQASFRGHITRKKMKDGEEEKEGDSPAAAEEAKEGGEEVKKAEGEEAPAQQEEGAGEEAKKEEETSQAKSPVADKPANSPAAAATSPVAAAPAAASPTAAAAPSEPQKEEPKVEEKAEEKPKEVEAPAAAAKSPTTATAEEKKEEEKSEEKKEEARQADVPAVSPTAEKEEPNQTKDAAEESKAEEAAPADAAAETTESKDD",
"proteome": "UP000472267",
"gene": "gap43",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0040008",
"name": "regulation of growth",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e03e8336df524fecc35c19eeb84c60d1fbbc00e0",
"counters": {
"domain_architectures": 236,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cathgene3d": 1,
"smart": 1,
"profile": 1,
"prints": 1,
"prosite": 2,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 236
}
}
}