GET /api/protein/UniProt/A0A671Z3Y6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A671Z3Y6",
"id": "A0A671Z3Y6_SPAAU",
"source_organism": {
"taxId": "8175",
"scientificName": "Sparus aurata",
"fullName": "Sparus aurata (Gilthead sea bream)"
},
"name": "Cellular retinoic acid-binding protein 1",
"description": [
"Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors"
],
"length": 134,
"sequence": "MPVDLNGYWKMISSDNFEEYLKALDVNVAIRKIATLLKPDKDIAHDGDHIVIKTLSTFKNYNMDFHVGKEFEEDLSGVDDRKCMTTINWDGDKLVCVQKGEIEGRGWTHWVTGDELHLELRAGGVVCHQIFKKS",
"proteome": "UP000472265",
"gene": "RBP1",
"go_terms": [
{
"identifier": "GO:0008289",
"name": "lipid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8ba10142da31472221cfebba1b934f343d27763b",
"counters": {
"domain_architectures": 23661,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 23661
}
}
}