GET /api/protein/UniProt/A0A671NHM2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A671NHM2",
"id": "A0A671NHM2_9TELE",
"source_organism": {
"taxId": "1608454",
"scientificName": "Sinocyclocheilus anshuiensis",
"fullName": "Sinocyclocheilus anshuiensis"
},
"name": "Glycoprotein hormone beta-5",
"description": [
"Functions as a heterodimeric glycoprotein hormone with GPHA2 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production. Plays a central role in controlling thyroid cell metabolism"
],
"length": 139,
"sequence": "MAPLRSGAQGLSPVTLCCVTLAVWLCCGAQTETSVLNLKRFIGCAVREFTFLARKPGCSGLHITTDACWGRCETWEKPVLDPPFIESHQRVCTYSETRLEMVQLPNCSADVDPSYTYPVALRCDCGVCLTSTTECITSV",
"proteome": "UP000472260",
"gene": "gphb5",
"go_terms": [
{
"identifier": "GO:0005179",
"name": "hormone activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "98a435d7a25d82e42884f0ece7da600b2af78af9",
"counters": {
"domain_architectures": 5475,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5475
}
}
}