GET /api/protein/UniProt/A0A671MYG9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A671MYG9",
        "id": "A0A671MYG9_9TELE",
        "source_organism": {
            "taxId": "1608454",
            "scientificName": "Sinocyclocheilus anshuiensis",
            "fullName": "Sinocyclocheilus anshuiensis"
        },
        "name": "Transcription initiation factor IIB",
        "description": [
            "General transcription factor that plays a role in transcription initiation by RNA polymerase II (Pol II). Involved in the pre-initiation complex (PIC) formation and Pol II recruitment at promoter DNA. Together with the TATA box-bound TBP forms the core initiation complex and provides a bridge between TBP and the Pol II-TFIIF complex. Released from the PIC early following the onset of transcription during the initiation and elongation transition and reassociates with TBP during the next transcription cycle. Associates with chromatin to core promoter-specific regions. Binds to two distinct DNA core promoter consensus sequence elements in a TBP-independent manner; these IIB-recognition elements (BREs) are localized immediately upstream (BREu), 5'-[GC][GC][GA]CGCC-3', and downstream (BREd), 5'-[GA]T[TGA][TG][GT][TG][TG]-3', of the TATA box element. Modulates transcription start site selection. Also exhibits autoacetyltransferase activity that contributes to the activated transcription"
        ],
        "length": 316,
        "sequence": "MASTSRGDSLPKVQCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFTNEKATKDPSRVGDTQNPLLNGGDLTTMISKGTGAASFDEFGNSKYQNRRTMSSSDRAMLNAFKEITTMADRINLPRNIIDRTNNLFKQVYEQKSLKGRSNDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLGLPKQVQMAATYIARKAVELDLVPGRSPISVAAAAIYMASQASAEKKTQKEIGDIAGVADVTIRQSYRLIYPRAADLFPPDFKFDTPVDKLPQL",
        "proteome": "UP000472260",
        "gene": "gtf2b",
        "go_terms": [
            {
                "identifier": "GO:0017025",
                "name": "TBP-class protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006352",
                "name": "DNA-templated transcription initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0070897",
                "name": "transcription preinitiation complex assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "772dbcad1d824cceac903d513ec89c78fd988f59",
        "counters": {
            "domain_architectures": 8182,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 1,
                "ssf": 2,
                "pfam": 2,
                "cdd": 2,
                "smart": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8182
        }
    }
}