GET /api/protein/UniProt/A0A669P3X2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A669P3X2",
"id": "A0A669P3X2_PHACC",
"source_organism": {
"taxId": "9054",
"scientificName": "Phasianus colchicus",
"fullName": "Phasianus colchicus (Common pheasant)"
},
"name": "Glucoside xylosyltransferase 1",
"description": [
"Glycosyltransferase which elongates the O-linked glucose attached to EGF-like repeats in the extracellular domain of Notch proteins by catalyzing the addition of xylose"
],
"length": 433,
"sequence": "MRRFARVALLFLGCGVCSLLYGVSQLALSLEQEAGGGRQRQARDSAAPGGGRQAGKAGRGEEGAGRCQNLSVSFWNSYWMLPSDVCGVNCFWEAAFRYNDMKTQPSETVHLAVVACGERLEETVTMLRSAIIFSIKPLQFHIFAEDQLHESFKDILDDFPYEGKVNYTLYPITFPSEGAKEWKKLFKPCASQRLFLPLILKDVDSLLYVDTDILFLRPVDDIWAFLRKFNSTQIAAMAPEHEEPRIGWYNRFARHPYYGATGINSGVMLMNMTRIRRKYFKNDMTTVRLRWGEILMPLLKKYKLNITWGDQDLLNIMFFHNPESLYIFPCQWNYRPDHCIYGSNCKEAEEEGIFILHGNRGVYHDDKQPTFRAVYEAIKNYSFGDDLVRSLLQPLELELQKTVHTYCGRVYEVFIKQLKKSIRDLSIRRSKGS",
"proteome": "UP000472261",
"gene": "GXYLT1",
"go_terms": [
{
"identifier": "GO:0016757",
"name": "glycosyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c94647be06e40a638688f530ad619dabee70dfec",
"counters": {
"domain_architectures": 38856,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cdd": 1,
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 38856
}
}
}