HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A669ER40",
"id": "A0A669ER40_ORENI",
"source_organism": {
"taxId": "8128",
"scientificName": "Oreochromis niloticus",
"fullName": "Oreochromis niloticus (Nile tilapia)"
},
"name": "Fat storage-inducing transmembrane protein 1 homolog",
"description": [
"May play a role in the formation of lipid droplets (LDs), which are storage organelles at the center of lipid and energy homeostasis. May directly bind to diacylglycerol (DAGs) and triacylglycerol"
],
"length": 288,
"sequence": "MFLNTVLVVLTDLAARFMGTTLFRRHFHLLLSALVMFGPMLSLWVSHHSIFAKKNHFLYRMFLHSGWGWTCIFVGSFVFLLSFSIRRSLSLSIRHLSRLAVAGGLWLSFCKLLDLLENATGSCYEPLEAGTVVTNGQTLLVLREGESKSECLKAGMLWRGYEVSEDIFLLCLCCLLLVEETAVFGPYLSLGGISDAPLRILFLFCVLLLWLWIFLLLCLLAYFPQFPTQLLGGALGCLSWRGLYQGWYRLGPSWYCPGRPGLGLLNIKAIGNDVEDAQLKQPNHDHCN",
"proteome": "UP000005207",
"gene": "fitm1l",
"go_terms": [
{
"identifier": "GO:0008654",
"name": "phospholipid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0019915",
"name": "lipid storage",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0034389",
"name": "lipid droplet organization",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0010945",
"name": "coenzyme A diphosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005789",
"name": "endoplasmic reticulum membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0df6fc065a0fc2f8a871a302178b9bf19d5ee16d",
"counters": {
"domain_architectures": 2223,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"hamap": 2,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2223
}
}
}