General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A669ER40",
        "id": "A0A669ER40_ORENI",
        "source_organism": {
            "taxId": "8128",
            "scientificName": "Oreochromis niloticus",
            "fullName": "Oreochromis niloticus (Nile tilapia)"
        },
        "name": "Fat storage-inducing transmembrane protein 1 homolog",
        "description": [
            "May play a role in the formation of lipid droplets (LDs), which are storage organelles at the center of lipid and energy homeostasis. May directly bind to diacylglycerol (DAGs) and triacylglycerol"
        ],
        "length": 288,
        "sequence": "MFLNTVLVVLTDLAARFMGTTLFRRHFHLLLSALVMFGPMLSLWVSHHSIFAKKNHFLYRMFLHSGWGWTCIFVGSFVFLLSFSIRRSLSLSIRHLSRLAVAGGLWLSFCKLLDLLENATGSCYEPLEAGTVVTNGQTLLVLREGESKSECLKAGMLWRGYEVSEDIFLLCLCCLLLVEETAVFGPYLSLGGISDAPLRILFLFCVLLLWLWIFLLLCLLAYFPQFPTQLLGGALGCLSWRGLYQGWYRLGPSWYCPGRPGLGLLNIKAIGNDVEDAQLKQPNHDHCN",
        "proteome": "UP000005207",
        "gene": "fitm1l",
        "go_terms": [
            {
                "identifier": "GO:0008654",
                "name": "phospholipid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019915",
                "name": "lipid storage",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0034389",
                "name": "lipid droplet organization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0010945",
                "name": "coenzyme A diphosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005789",
                "name": "endoplasmic reticulum membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0df6fc065a0fc2f8a871a302178b9bf19d5ee16d",
        "counters": {
            "domain_architectures": 2223,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 2,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2223
        }
    }
}