GET /api/protein/UniProt/A0A669B2K4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A669B2K4",
        "id": "A0A669B2K4_ORENI",
        "source_organism": {
            "taxId": "8128",
            "scientificName": "Oreochromis niloticus",
            "fullName": "Oreochromis niloticus (Nile tilapia)"
        },
        "name": "Cocaine- and amphetamine-regulated transcript protein",
        "description": null,
        "length": 102,
        "sequence": "MWARAVLCAVLLSALCPAGKTEAERDEREVQDYHNSNRLLGALHEVLERLQTKRINPWEKKYGQVPSCDLGEYCAIRKGSRIGKMCDCPRGAFCNFFLLKCL",
        "proteome": "UP000005207",
        "gene": "CARTPT",
        "go_terms": [
            {
                "identifier": "GO:0005184",
                "name": "neuropeptide hormone activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007186",
                "name": "G protein-coupled receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008343",
                "name": "adult feeding behavior",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0032099",
                "name": "negative regulation of appetite",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0043410",
                "name": "positive regulation of MAPK cascade",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005615",
                "name": "extracellular space",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0009267",
                "name": "cellular response to starvation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "83f6614153d25297dc27cca7f297747cba7f4a09",
        "counters": {
            "domain_architectures": 1870,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1870
        }
    }
}