General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A668V692",
        "id": "A0A668V692_OREAU",
        "source_organism": {
            "taxId": "47969",
            "scientificName": "Oreochromis aureus",
            "fullName": "Oreochromis aureus (Israeli tilapia)"
        },
        "name": "Gamma-synuclein",
        "description": [
            "Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway"
        ],
        "length": 124,
        "sequence": "MDVFKKGFSMAKDGVVAAAEKTKAGVEEAAAKTKEGVIYVGSKTMEGVVTGVNTVAQKTTEQANVVADTAVSGANEVAQATVQGVENAAAATRFVSTEEAEPVPEETELQKPDAGGEQTEQAAQ",
        "proteome": "UP000472276",
        "gene": "sncga",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ba377935bbbad4e8c0f939864858b21a58ebc159",
        "counters": {
            "domain_architectures": 3377,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3377
        }
    }
}