General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A665TE00",
        "id": "A0A665TE00_ECHNA",
        "source_organism": {
            "taxId": "173247",
            "scientificName": "Echeneis naucrates",
            "fullName": "Echeneis naucrates (Live sharksucker)"
        },
        "name": "Four and a half LIM domains protein 3",
        "description": [
            "Recruited by SOX15 to FOXK1 promoters where it acts as a transcriptional coactivator of FOXK1"
        ],
        "length": 279,
        "sequence": "MADRFDCDNCKESLYGRKYIQSDDSPYCIPCYDSLFSNTCDECKELIGHDARELFYEDRHYHEHCFRCFRCDRSLADEPFTSQGEALLCNDCYCNEFSSKCVACDKIVMPGTRKLEYGGSTWHEACFICHSCEQPIGSKSFIPDKDEHYCVPCYEDKFAPRCTRCKKTLAKGGVTYRDEPWHKECFVCTSCKTQLAGQHFTSRDDSPYCLKCFGSLYAKKCEACSKPITGFGGGKYISFEERQWHQPCFTCSQCSVSLVGAGFFPDGERILCRDCHSNL",
        "proteome": "UP000472264",
        "gene": "fhl3a",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "60f867819c5f5c28746da8498f529068ab918b1f",
        "counters": {
            "domain_architectures": 3726,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 2,
                "ssf": 1,
                "cdd": 4,
                "profile": 1,
                "smart": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3726
        }
    }
}