HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A663LL51",
"id": "A0A663LL51_ATHCN",
"source_organism": {
"taxId": "194338",
"scientificName": "Athene cunicularia",
"fullName": "Athene cunicularia (Burrowing owl)"
},
"name": "Transcription initiation factor TFIID subunit 13",
"description": [
"The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription. TFIID recognizes and binds promoters via its subunit TBP, a TATA-box-binding protein, and promotes assembly of the pre-initiation complex (PIC). The TFIID complex consists of TBP and TBP-associated factors (TAFs), including TAF1, TAF2, TAF3, TAF4, TAF5, TAF6, TAF7, TAF8, TAF9, TAF10, TAF11, TAF12 and TAF13. TAF13, together with TAF11 and TBP, play key roles during promoter binding by the TFIID and TFIIA transcription factor complexes"
],
"length": 124,
"sequence": "MADEEEDAPFEEDAEEAGGGLDGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS",
"proteome": "UP000472269",
"gene": "TAF13",
"go_terms": [
{
"identifier": "GO:0046982",
"name": "protein heterodimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006366",
"name": "transcription by RNA polymerase II",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1497f6da993d62f303d74c605ae360f65eca4381",
"counters": {
"domain_architectures": 7569,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7569
}
}
}