GET /api/protein/UniProt/A0A663E185/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A663E185",
"id": "A0A663E185_AQUCH",
"source_organism": {
"taxId": "223781",
"scientificName": "Aquila chrysaetos chrysaetos",
"fullName": "Aquila chrysaetos chrysaetos"
},
"name": "Leptin receptor overlapping transcript-like 1",
"description": [
"Negatively regulates growth hormone (GH) receptor cell surface expression in liver. May play a role in liver resistance to GH during periods of reduced nutrient availability"
],
"length": 131,
"sequence": "MAGIKALISLSFGGAVGLMFLMLGCALPQYNQYWPLFVLFFYILSPIPYCIARRLVDDTDATSNACKELAIFLTTGIVVSAFGLPIVFARAELIYWGACALVLTGNTVIFATILGFFLVFGSNDDFSWQQW",
"proteome": "UP000472275",
"gene": "LEPROTL1",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "443a18aff7c840205fb1b4f44a2ca854efb30db9",
"counters": {
"domain_architectures": 5632,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5632
}
}
}