GET /api/protein/UniProt/A0A657PJY2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A657PJY2",
        "id": "A0A657PJY2_9GAMM",
        "source_organism": {
            "taxId": "2548426",
            "scientificName": "Candidatus Sedimenticola endophacoides",
            "fullName": "Candidatus Sedimenticola endophacoides"
        },
        "name": "Ribosomal RNA small subunit methyltransferase A",
        "description": [
            "Specifically dimethylates two adjacent adenosines (A1518 and A1519) in the loop of a conserved hairpin near the 3'-end of 16S rRNA in the 30S particle. May play a critical role in biogenesis of 30S subunits"
        ],
        "length": 264,
        "sequence": "MNHRPRKRFGQNFLHDPGVIARIVSSIAPRPGDNLVEIGPGQGAITVQLLRAAGSMSAVELDRDLIEPLTRLCADLGQLEIYSADALRFDFARLARPGHPLRLVGNLPYNISTPLLFHLLECRAPVRDMHFMLQKEVVERMAAAPGGKEYGRLSVMLQVRCRVEPLFDIGPGAFRPAPKVESAFVRLLPFATPPYQIDDGVRFAAIVAAAFSQRRKTLRNSLRKLVEEAHFEHAGVDPALRAERLPVRGFVDLANAACNDPDPA",
        "proteome": "UP000243361",
        "gene": "rsmA",
        "go_terms": [
            {
                "identifier": "GO:0000179",
                "name": "rRNA (adenine-N6,N6-)-dimethyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000154",
                "name": "rRNA modification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006364",
                "name": "rRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4b0de80b0859cbff9c9536f8e831ccc961a856e4",
        "counters": {
            "domain_architectures": 41394,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 1,
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 41394
        }
    }
}