GET /api/protein/UniProt/A0A654KW03/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A654KW03",
"id": "A0A654KW03_ACIBM",
"source_organism": {
"taxId": "497978",
"scientificName": "Acinetobacter baumannii (strain MDR-ZJ06)",
"fullName": "Acinetobacter baumannii (strain MDR-ZJ06)"
},
"name": "Peptide methionine sulfoxide reductase MsrA",
"description": [
"Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine"
],
"length": 173,
"sequence": "MQQALFGGGCFWCVEAVFLQIRGVEKVTSGYAGGHTTHPTYEQVCQGDTQHAEVVLIDFDEQQVTYSQLLDVFFATHDPTTLNRQGNDIGTQYRSVIYYFNEEQKQAAEHTIQTLKDDDLDIVTELSPAPTFYPAEDYHQNYYEKNPSQGYCNFAIPPKLLKLHSKFQHLMKN",
"proteome": null,
"gene": "msrA",
"go_terms": [
{
"identifier": "GO:0008113",
"name": "peptide-methionine (S)-S-oxide reductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "47a64c36b2d13edfc0db84d999e2ce356181eb1f",
"counters": {
"domain_architectures": 38973,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 38973
}
}
}