GET /api/protein/UniProt/A0A654FAC2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A654FAC2",
        "id": "A0A654FAC2_ARATH",
        "source_organism": {
            "taxId": "3702",
            "scientificName": "Arabidopsis thaliana",
            "fullName": "Arabidopsis thaliana (Mouse-ear cress)"
        },
        "name": "Thioredoxin domain-containing protein",
        "description": [
            "Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds"
        ],
        "length": 483,
        "sequence": "MVSSTKLKSVDFYRKIPRDLTEASLSGAGLSIVAALFMMFLFGMELSSYLEVNTTTAVIVDKSSDGDFLRIDFNISFPALSCEFASVDVSDVLGTNRLNITKTVRKFPIDPHLRSTGAEFHSGLALHNINHGEETKEEFPDGAIPLTSASFEALSHHFPILVVNFNAPWCYWSNRLKPSWEKAANIIKQRYDPEADGRVLLGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHESYYGDRDTDSIVKMVEGLVAPIHPETHKVALDGKSNDTVKHLKKGPVTGGCRVEGYVRVKKVPGNLVISAHSGAHSFDSSQMNMSHVVSHFSFGRMISPRLLTDMKRLLPYLGLSHDRLDGKAFINQHEFGANVTIEHYLQTVKTEVITRRSGQEHSLIEEYEYTAHSSVAQTYYLPVAKFHFELSPMQILITENPKSFSHFITNLCAIIGGVFTVAGILDSIFHNTVRLVKKVELGKNI",
        "proteome": null,
        "gene": "AN1_LOCUS13485",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1cfbafe524d8ba9220b81aaa9818abad23ff9631",
        "counters": {
            "domain_architectures": 1129,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 3,
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1129
        }
    }
}