GET /api/protein/UniProt/A0A654FAC2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A654FAC2",
"id": "A0A654FAC2_ARATH",
"source_organism": {
"taxId": "3702",
"scientificName": "Arabidopsis thaliana",
"fullName": "Arabidopsis thaliana (Mouse-ear cress)"
},
"name": "Thioredoxin domain-containing protein",
"description": [
"Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds"
],
"length": 483,
"sequence": "MVSSTKLKSVDFYRKIPRDLTEASLSGAGLSIVAALFMMFLFGMELSSYLEVNTTTAVIVDKSSDGDFLRIDFNISFPALSCEFASVDVSDVLGTNRLNITKTVRKFPIDPHLRSTGAEFHSGLALHNINHGEETKEEFPDGAIPLTSASFEALSHHFPILVVNFNAPWCYWSNRLKPSWEKAANIIKQRYDPEADGRVLLGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHESYYGDRDTDSIVKMVEGLVAPIHPETHKVALDGKSNDTVKHLKKGPVTGGCRVEGYVRVKKVPGNLVISAHSGAHSFDSSQMNMSHVVSHFSFGRMISPRLLTDMKRLLPYLGLSHDRLDGKAFINQHEFGANVTIEHYLQTVKTEVITRRSGQEHSLIEEYEYTAHSSVAQTYYLPVAKFHFELSPMQILITENPKSFSHFITNLCAIIGGVFTVAGILDSIFHNTVRLVKKVELGKNI",
"proteome": null,
"gene": "AN1_LOCUS13485",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1cfbafe524d8ba9220b81aaa9818abad23ff9631",
"counters": {
"domain_architectures": 1129,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 3,
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1129
}
}
}