HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A654AIB8",
"id": "A0A654AIB8_9GAMM",
"source_organism": {
"taxId": "664683",
"scientificName": "Vreelandella titanicae",
"fullName": "Vreelandella titanicae"
},
"name": "Threonylcarbamoyl-AMP synthase",
"description": [
"Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Catalyzes the conversion of L-threonine, HCO(3)(-)/CO(2) and ATP to give threonylcarbamoyl-AMP (TC-AMP) as the acyladenylate intermediate, with the release of diphosphate"
],
"length": 185,
"sequence": "MSLATDLAPAISALRSGGVIACPTEAVWGLSCDPENDAALAHLMRMKERDPAKGVILVAANIGQFHPWLSQLPLAMHAPLAASWPGPNTWLVPDYGRSHGLVRGAHERVALRVTDHPVMKALCEAFGGPLVSTSANRSGEPPAMSAAEITDIFADEVAYIVQGELGGNAKPSTIRDLATGKIMRS",
"proteome": "UP000509761",
"gene": "tsaC",
"go_terms": [
{
"identifier": "GO:0003725",
"name": "double-stranded RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0002949",
"name": "tRNA threonylcarbamoyladenosine modification",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "fd062f70d155d26836135770b3359d66636068af",
"counters": {
"domain_architectures": 32487,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"pfam": 1,
"hamap": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 32487
}
}
}