HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A653CHG6",
"id": "A0A653CHG6_CALMS",
"source_organism": {
"taxId": "64391",
"scientificName": "Callosobruchus maculatus",
"fullName": "Callosobruchus maculatus (Southern cowpea weevil)"
},
"name": "Prostaglandin reductase 1",
"description": null,
"length": 328,
"sequence": "MVKSKVFLYNKKFEGLPKESDFKLVEENVPALKDGEFLAEAAYLSVDPYMRAYAVGLPTGIPMIGGQVAKVIESKNSKFPVGSYVHGQFGWRTHTVDNGATVNMMPTYVLPDFGSLPPSLGVGILGMPGNTAYFGFLELCQPKDGETVVVSGAAGAVGSIVGQIAKIKGCKVIGIAGSEEKGKWLVDELGFDHFINYKTQDIEAMLKKLAPKGVDCYFDNVGGETTDKVMLNMNTFGRISMCGAISGYNGAPAKIVQFPIVQKQLKVEGFIVTRWADRWMEGIEQLSKWIKEGKLKYRETVTDGFENMPKAFIDMLKGGNTGKAVVKA",
"proteome": "UP000410492",
"gene": "CALMAC_LOCUS9157",
"go_terms": [
{
"identifier": "GO:0032440",
"name": "2-alkenal reductase [NAD(P)H] activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0047522",
"name": "15-oxoprostaglandin 13-reductase [NAD(P)+] activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016628",
"name": "oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5868aa2108b93d49c5c92d05158401122f1a86a6",
"counters": {
"domain_architectures": 28175,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cdd": 1,
"smart": 1,
"cathgene3d": 2,
"pfam": 2,
"panther": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 28175
}
}
}