GET /api/protein/UniProt/A0A636NZB6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A636NZB6",
        "id": "A0A636NZB6_SALET",
        "source_organism": {
            "taxId": "2564497",
            "scientificName": "Salmonella enterica subsp. enterica serovar Guildford",
            "fullName": "Salmonella enterica subsp. enterica serovar Guildford"
        },
        "name": "Probable oxaloacetate decarboxylase gamma chain",
        "description": [
            "Catalyzes the decarboxylation of oxaloacetate coupled to Na(+) translocation"
        ],
        "length": 80,
        "sequence": "MTNAALLLGEGFTLMLLGMGFVLAFLFLLIFAIRGMSAVITRFFPEPVAAPAPRAVPAVDDFTRLKPVIAAAIHHHRLNA",
        "proteome": null,
        "gene": "oadG",
        "go_terms": [
            {
                "identifier": "GO:0015081",
                "name": "sodium ion transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0036376",
                "name": "sodium ion export across plasma membrane",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c89c58ce849afbd27e3d0b46f7d78875a9d09755",
        "counters": {
            "domain_architectures": 5468,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "ncbifam": 2,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5468
        }
    }
}