GET /api/protein/UniProt/A0A5S9F174/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A5S9F174",
        "id": "A0A5S9F174_UABAM",
        "source_organism": {
            "taxId": "2596890",
            "scientificName": "Uabimicrobium amorphum",
            "fullName": "Uabimicrobium amorphum"
        },
        "name": "ATP synthase subunit c",
        "description": [
            "F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation",
            "Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits"
        ],
        "length": 82,
        "sequence": "MFILEAVAAGKGLGLFGAALGAGIAAIGAGMGIGKIGASSVESMARQPEHKGDIRGAMILTAAFVEGVALFAVVVCLLISFQ",
        "proteome": "UP000326354",
        "gene": "atpE",
        "go_terms": [
            {
                "identifier": "GO:0015078",
                "name": "proton transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:1902600",
                "name": "proton transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0033177",
                "name": "proton-transporting two-sector ATPase complex, proton-transporting domain",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0015986",
                "name": "proton motive force-driven ATP synthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045259",
                "name": "proton-transporting ATP synthase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d0c91cd7e80ef1f8ea234c0ac103454bbd7aff98",
        "counters": {
            "domain_architectures": 49652,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 49652
        }
    }
}