GET /api/protein/UniProt/A0A5P1RF66/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A5P1RF66",
"id": "A0A5P1RF66_9GAMM",
"source_organism": {
"taxId": "1031538",
"scientificName": "Neptunomonas concharum",
"fullName": "Neptunomonas concharum"
},
"name": "Pyrimidine/purine nucleoside phosphorylase",
"description": [
"Catalyzes the phosphorolysis of diverse nucleosides, yielding D-ribose 1-phosphate and the respective free bases. Can use uridine, adenosine, guanosine, cytidine, thymidine, inosine and xanthosine as substrates. Also catalyzes the reverse reactions"
],
"length": 92,
"sequence": "MNVNEYFDGQVKSIGFENKEGNVTAGVMAPGEYEFGTSQKELMKVVSGELIVKLPGAAEFQSFPAGTEFNVDANQSFQLKVEQATAYLCFYS",
"proteome": "UP000324760",
"gene": "ppnP",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cb075b3ccb9d7f5677132b0cb821b74f2816dd8b",
"counters": {
"domain_architectures": 5497,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5497
}
}
}