GET /api/protein/UniProt/A0A5P1R6B4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A5P1R6B4",
"id": "A0A5P1R6B4_9GAMM",
"source_organism": {
"taxId": "1031538",
"scientificName": "Neptunomonas concharum",
"fullName": "Neptunomonas concharum"
},
"name": "Oxygen-dependent coproporphyrinogen-III oxidase",
"description": [
"Involved in the heme biosynthesis. Catalyzes the aerobic oxidative decarboxylation of propionate groups of rings A and B of coproporphyrinogen-III to yield the vinyl groups in protoporphyrinogen-IX"
],
"length": 304,
"sequence": "MSAPDIDAVKRYLLDLQDRICDALTEADGQQTFIEDSWERPQGGGGRTRVISDGAIFEKGGVNFSHVFGGALPASATAHRPELAGRSFEAMGVSLVMHPKNPYIPTSHANVRFFIAEKEGEDPVWWFGGGFDLTPYYGNDDDCRHWHLTAKAACEPFGETIYPHYKQWCDEYFHLKHRDEPRGIGGLFFDDLNELGFEKSFALMQSIGNAYIPAYIPIIERRKDTPYGERQRDFQLHRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPEVRWGYDWKPEPGTEEAQLYERYLKPIDWAGA",
"proteome": "UP000324760",
"gene": "hemF",
"go_terms": [
{
"identifier": "GO:0004109",
"name": "coproporphyrinogen oxidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006779",
"name": "porphyrin-containing compound biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "97f62c4bbc5df6f2ae641c578c8a1aafbda2cf84",
"counters": {
"domain_architectures": 16872,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"pirsf": 1,
"pfam": 1,
"prosite": 1,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 16872
}
}
}