General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A5N6V703",
        "id": "LP9A_ASPTM",
        "source_organism": {
            "taxId": "41984",
            "scientificName": "Aspergillus tamarii",
            "fullName": "Aspergillus tamarii"
        },
        "name": "AA9 family lytic polysaccharide monooxygenase A",
        "description": [
            "Lytic polysaccharide monooxygenase (LPMO) that depolymerizes crystalline and amorphous polysaccharides via the oxidation of scissile alpha- or beta-(1-4)-glycosidic bonds, yielding exclusively C4 oxidation products (PubMed:32640001). Catalysis by LPMOs requires the reduction of the active-site copper from Cu(II) to Cu(I) by a reducing agent and H(2)O(2) or O(2) as a cosubstrate (PubMed:32640001). In addition to cellulose, also cleaves the beta-(1!4)-glucan backbone of tamarind xyloglucan, but only next to unsubstituted glucosyl units (PubMed:32640001)"
        ],
        "length": 373,
        "sequence": "MKSSTFGMLALAAAAKLVSAHTTVHAVWINDVDQGEGNSQSGYIRSPPSNSPITDVTSKDMTCNVNNKATAKTLEVKAGDKITFEWHHDSRSESDDIIASSHNGPILVYMAPTEKGTAGNGWVKIAEDGYTDGTWAVETLIKNRGKHSVTVPDVAAGEYLFRPEIIALHEGNREGGAQFYMECVQVKVTSSGSKTLPEGVSIPGAYTATDKGILFNIYDSFDSYPIPGPAVWDGASGSSSSSSSSASASAPAPTSAAPAPSSFTTIAKQPATSSSTEAPSTENTPSETTSTTSAIVSTTAVASTTAPATPSTTSAIASSAAPTNSVPQPSSNAGGAVKEWYQCGGLNYSGSTQCEEGLTCKKWNPYYHQCVSA",
        "proteome": "UP000326950",
        "gene": "BDV40DRAFT_254541",
        "go_terms": [
            {
                "identifier": "GO:0030248",
                "name": "cellulose binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0ee351bc19c4eac8c2647414ef821eabcc14df1e",
        "counters": {
            "domain_architectures": 2831,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2831
        }
    }
}