General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A5N5NDN7",
        "id": "A0A5N5NDN7_PANHP",
        "source_organism": {
            "taxId": "310915",
            "scientificName": "Pangasianodon hypophthalmus",
            "fullName": "Pangasianodon hypophthalmus (Striped catfish)"
        },
        "name": "palmitoyl-CoA hydrolase",
        "description": [
            "Catalyzes the cleavage of thioester bonds from S-palmitoyl-CoA or S-palmitoyl-N-acetylcysteamine (unbranched structures) but does not have activity against palmitoylcysteine or palmitoylated proteins, branched structures or bulky head groups. Conversely, hydrolyzes both long and short chain fatty acyl-CoA substrate"
        ],
        "length": 298,
        "sequence": "MKRLAFRGKCAHSSVLVCCLLLCSVCVCVLGYKPVIVIHGLFDTSADFINLKRYINQSHPGTNVSVIDLFDRTASLEPLWKQVEGFKEAIYPIMQNAADGVHLLCYSQGGLVCRGILSTLNDHNVHSFISLSSPQAGQYGDTDYLKYFFPEFVKSNLYHLCYTAVGQRISICNYWNDPHHRDMYMNTSDYLAPLNNERPHPESAVWKQNFLRIKKLVLIGGPDDGVIMPWQSSQFGFYDENETVVEMKSQEMFLRDSFGLKSLYARGDLELCSVAGVPHIYWHSNETVYKSCIDKWLT",
        "proteome": "UP000327468",
        "gene": "PHYPO_G00239980",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "743bde08862655ba68b3bd3766f0e25731900d15",
        "counters": {
            "domain_architectures": 9875,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 9875
        }
    }
}