GET /api/protein/UniProt/A0A5N5NDN7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A5N5NDN7",
"id": "A0A5N5NDN7_PANHP",
"source_organism": {
"taxId": "310915",
"scientificName": "Pangasianodon hypophthalmus",
"fullName": "Pangasianodon hypophthalmus (Striped catfish)"
},
"name": "palmitoyl-CoA hydrolase",
"description": [
"Catalyzes the cleavage of thioester bonds from S-palmitoyl-CoA or S-palmitoyl-N-acetylcysteamine (unbranched structures) but does not have activity against palmitoylcysteine or palmitoylated proteins, branched structures or bulky head groups. Conversely, hydrolyzes both long and short chain fatty acyl-CoA substrate"
],
"length": 298,
"sequence": "MKRLAFRGKCAHSSVLVCCLLLCSVCVCVLGYKPVIVIHGLFDTSADFINLKRYINQSHPGTNVSVIDLFDRTASLEPLWKQVEGFKEAIYPIMQNAADGVHLLCYSQGGLVCRGILSTLNDHNVHSFISLSSPQAGQYGDTDYLKYFFPEFVKSNLYHLCYTAVGQRISICNYWNDPHHRDMYMNTSDYLAPLNNERPHPESAVWKQNFLRIKKLVLIGGPDDGVIMPWQSSQFGFYDENETVVEMKSQEMFLRDSFGLKSLYARGDLELCSVAGVPHIYWHSNETVYKSCIDKWLT",
"proteome": "UP000327468",
"gene": "PHYPO_G00239980",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "743bde08862655ba68b3bd3766f0e25731900d15",
"counters": {
"domain_architectures": 9875,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 9875
}
}
}