General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A5N4CNE4",
        "id": "A0A5N4CNE4_CAMDR",
        "source_organism": {
            "taxId": "9838",
            "scientificName": "Camelus dromedarius",
            "fullName": "Camelus dromedarius (Dromedary)"
        },
        "name": "Ephrin-A4",
        "description": [
            "Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. May play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils"
        ],
        "length": 204,
        "sequence": "MRLQPLLRTVLWAALLSSPLRGGSGLRHEVYWNSSNPRLLRGDAVVELGLKDYLDIFCPHYESPGPPEGPETFALYMVDRPGYEACRAEGPGAFKRWECSLPFAPFGPVRFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESPGQCLRLQVSVCCKEDKPESAHPVGSPGESGTSGWQGGATPSPLCLLLLLLLPILRLLRVL",
        "proteome": "UP000299084",
        "gene": "Ephrin-A4",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0046875",
                "name": "ephrin receptor binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0048013",
                "name": "ephrin receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8209c025ff4ca30f35b2f3c8ca3610205b6ca4c1",
        "counters": {
            "domain_architectures": 8598,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 1,
                "cdd": 1,
                "ssf": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8598
        }
    }
}