General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A5M9MEP0",
        "id": "A0A5M9MEP0_9EURO",
        "source_organism": {
            "taxId": "1220188",
            "scientificName": "Aspergillus tanneri",
            "fullName": "Aspergillus tanneri"
        },
        "name": "Small nuclear ribonucleoprotein Sm D1",
        "description": [
            "Involved in splicing regulation. Facilitates post-transcriptional gene silencing (PTGS) by limiting the degradation of transgene aberrant RNAs by the RNA quality control (RQC) machinery, thus favoring their entry into cytoplasmic siRNA bodies where they can trigger PTGS. Does not participate in the production of small RNAs",
            "Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome"
        ],
        "length": 169,
        "sequence": "MKLVRFLMKCTNETVTIELKNGTILHGTITSISPQMNTALRTVKMTPKGRDPISLDTINIRGSTIRYYILPDSLPLDTLLVDDQPKPKNKAQADGIMDDSKNDVAEAVVGVARTVFFDMLLSSDRSPQTAVLVSREIASSGWLNDTLYEKNSIILDTYTRMDVVLYNDI",
        "proteome": null,
        "gene": "ATNIH1004_008415",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000387",
                "name": "spliceosomal snRNP assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006396",
                "name": "RNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "83b18cf71a575d59c0de6840812ffe7912383fc4",
        "counters": {
            "domain_architectures": 70645,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 70645
        }
    }
}