GET /api/protein/UniProt/A0A5J6CKM3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A5J6CKM3",
"id": "A0A5J6CKM3_9ASTR",
"source_organism": {
"taxId": "239468",
"scientificName": "Phyteuma orbiculare",
"fullName": "Phyteuma orbiculare"
},
"name": "Maturase MatK N-terminal domain-containing protein",
"description": [
"Usually encoded in the trnK tRNA gene intron. Probably assists in splicing its own and other chloroplast group II introns"
],
"length": 128,
"sequence": "FSLRLLSCLEKFEKKGEGRVKSDNLQSIHSIFSFLEDKILHLHYVLDLLIPYPIHLEILVQALRYWLKDASALHFVRFFLHEFHNCNSLITSKKVGPSFSERNQRFFFFLYNSHVCEYESIFVFLRNQ",
"proteome": null,
"gene": "matK",
"go_terms": [
{
"identifier": "GO:0006397",
"name": "mRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009507",
"name": "chloroplast",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3a45752dde880af86d3686e9b201256f329b4034",
"counters": {
"domain_architectures": 17284,
"entries": 4,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 17284
}
}
}