General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A5J5CZW5",
        "id": "A0A5J5CZW5_9PERO",
        "source_organism": {
            "taxId": "54343",
            "scientificName": "Etheostoma spectabile",
            "fullName": "Etheostoma spectabile (orangethroat darter)"
        },
        "name": "tRNA selenocysteine 1-associated protein 1",
        "description": [
            "Involved in the early steps of selenocysteine biosynthesis and tRNA(Sec) charging to the later steps resulting in the cotranslational incorporation of selenocysteine into selenoproteins. Stabilizes the SECISBP2, EEFSEC and tRNA(Sec) complex. May be involved in the methylation of tRNA(Sec). Enhances efficiency of selenoproteins synthesis"
        ],
        "length": 308,
        "sequence": "MSTLWMGNLEAYMDEKFITRSFSTMGETVVNVRIIRNKMTGGALGYCFVEMSDEATAERCLRKINGKALPGANPPTRFKLNRATFGKQDSGQMYSLFVGDLTPEVDDGMLYEFFYNRYPSCRGGKVVLDSMGNSKGCGFVQFPDERLQKRALEECQGAVGLGGKPLRLSLAANNLRNRQQQQPSEHKSWQSNSGYRPSYDQYSQYQQQAYPGYYPSWGYDQTGAGYGYNYQLQYDYTQYPPAQESEAVQEDDGLEDPSPELDVVEANRKFMELSEELYDALIECHWQPADLSTQQDHMTSSLPEPIYC",
        "proteome": "UP000327493",
        "gene": "FQN60_007655",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "997d994ad7d02a13e24c43d86368553aeb26194c",
        "counters": {
            "domain_architectures": 1346,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "cdd": 2,
                "pfam": 2,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1346
        }
    }
}