GET /api/protein/UniProt/A0A5F7ZSB8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A5F7ZSB8",
"id": "A0A5F7ZSB8_MACMU",
"source_organism": {
"taxId": "9544",
"scientificName": "Macaca mulatta",
"fullName": "Macaca mulatta (Rhesus macaque)"
},
"name": "Golgin subfamily A member 7",
"description": [
"May be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS"
],
"length": 351,
"sequence": "MSWVAQPTRKLQRPIKNENNPSQSAIGNQLPQVTQPGNFVPHTPARSRLPQPHSSPRLSPSGNNLRGRKAGSALAPPTAFPFLGPAPQRAASAGWLYGQRRGAGCPVLAMRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVTLLLFSQKSLKIMKKASLLHMDAYTVIVAVKYLGAFIIQIVFRCTEAHSPESFKTGYSWYVHLQLTCQCSDWPTLKKNVENLYVLFLLSFLGMFLLYFPKCHSLLPPEFLPSLPSWLLAPELLISQLKMTRSQTSHLPILSVAPLSFQYHLWA",
"proteome": "UP000006718",
"gene": "GOLGA7",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7a3eb0b7bc4d98fbdd94b45c7cc7ad33d91e9cbc",
"counters": {
"domain_architectures": 6706,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6706
}
}
}