GET /api/protein/UniProt/A0A5E4B2M9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A5E4B2M9",
"id": "A0A5E4B2M9_MARMO",
"source_organism": {
"taxId": "9995",
"scientificName": "Marmota monax",
"fullName": "Marmota monax (Woodchuck)"
},
"name": "Centrosomal protein of 97 kDa",
"description": [
"Acts as a key negative regulator of ciliogenesis in collaboration with CCP110 by capping the mother centriole thereby preventing cilia formation. Required for recruitment of CCP110 to the centrosome"
],
"length": 602,
"sequence": "MAVARADATLPPGEGSVVNWSGQGLQKLGSNLPCEADIHTLILDKNQIIKLENLEKCKRLIQLSVANNRLVRMMGVAKLTQLRVLNLPHNSIGYVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNIPQIGDLSKLISLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQLSIMNNPCVMATPSIPGFDYRPYIVSWCLNLRVLDGYVISQKESLKAEWLYSQGKGRAYRPGQHIQLVQYLATVCPLTSTLGLQTAEDAKLEKILSKQRFHQRQLMNQSQNEEMSPLAPIETRVPLVPEHSSPVQDCQIVQESEPVIQVNSWVGISSNDDQLYAVKNSFPASTHTTRYSRNDLHLEDIQTDEDKLNCSLLSSESTFMPVASGLSPVSPTVELRLQGINLGLEDDGVANESVKELENQDLDKEEEKALWVSNEDSVQMLKSKISSEINEKAVLLPCPAPAIISAILKDDNQNLTCVSSGQNVSHTETDSEETMSQTTSEKFPCRILTQRSVALGQDKCTLQKLNEAATKLQAYWRGFYARNYNPQAKEVRYEIRLRRMQEHIVCLTDEIKKRKR",
"proteome": "UP000335636",
"gene": "MONAX_5E005353",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1e4f52c0f69cdc4b04d22fcb69cc7706976d4ffc",
"counters": {
"domain_architectures": 23518,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 2,
"smart": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 23518
}
}
}