GET /api/protein/UniProt/A0A5E4B2M9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A5E4B2M9",
        "id": "A0A5E4B2M9_MARMO",
        "source_organism": {
            "taxId": "9995",
            "scientificName": "Marmota monax",
            "fullName": "Marmota monax (Woodchuck)"
        },
        "name": "Centrosomal protein of 97 kDa",
        "description": [
            "Acts as a key negative regulator of ciliogenesis in collaboration with CCP110 by capping the mother centriole thereby preventing cilia formation. Required for recruitment of CCP110 to the centrosome"
        ],
        "length": 602,
        "sequence": "MAVARADATLPPGEGSVVNWSGQGLQKLGSNLPCEADIHTLILDKNQIIKLENLEKCKRLIQLSVANNRLVRMMGVAKLTQLRVLNLPHNSIGYVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNIPQIGDLSKLISLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQLSIMNNPCVMATPSIPGFDYRPYIVSWCLNLRVLDGYVISQKESLKAEWLYSQGKGRAYRPGQHIQLVQYLATVCPLTSTLGLQTAEDAKLEKILSKQRFHQRQLMNQSQNEEMSPLAPIETRVPLVPEHSSPVQDCQIVQESEPVIQVNSWVGISSNDDQLYAVKNSFPASTHTTRYSRNDLHLEDIQTDEDKLNCSLLSSESTFMPVASGLSPVSPTVELRLQGINLGLEDDGVANESVKELENQDLDKEEEKALWVSNEDSVQMLKSKISSEINEKAVLLPCPAPAIISAILKDDNQNLTCVSSGQNVSHTETDSEETMSQTTSEKFPCRILTQRSVALGQDKCTLQKLNEAATKLQAYWRGFYARNYNPQAKEVRYEIRLRRMQEHIVCLTDEIKKRKR",
        "proteome": "UP000335636",
        "gene": "MONAX_5E005353",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1e4f52c0f69cdc4b04d22fcb69cc7706976d4ffc",
        "counters": {
            "domain_architectures": 23518,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 2,
                "smart": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 23518
        }
    }
}