GET /api/protein/UniProt/A0A5E4AGH7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A5E4AGH7",
"id": "A0A5E4AGH7_MARMO",
"source_organism": {
"taxId": "9995",
"scientificName": "Marmota monax",
"fullName": "Marmota monax (Woodchuck)"
},
"name": "Eukaryotic translation initiation factor 4H",
"description": [
"Stimulates the RNA helicase activity of EIF4A in the translation initiation complex. Binds weakly mRNA"
],
"length": 228,
"sequence": "MADFDTYDDRAYSSFGGGRGSRGSSGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGFRDDFLGSRGGSRPGDRRAGPPMGSRFRDGPPLRGSNMDFREPTEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVHKEQE",
"proteome": "UP000335636",
"gene": "GHT09_006187",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0eb7dadcabd2c02a94f505008bf374cf6371f960",
"counters": {
"domain_architectures": 222038,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"profile": 1,
"smart": 1,
"pfam": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 222038
}
}
}