General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A5C4RZM0",
        "id": "A0A5C4RZM0_CHLTI",
        "source_organism": {
            "taxId": "115852",
            "scientificName": "Chlorobaculum thiosulfatiphilum",
            "fullName": "Chlorobaculum thiosulfatiphilum"
        },
        "name": "SoxAX cytochrome complex subunit A",
        "description": [
            "C-type monoheme cytochrome, which is part of the SoxAX cytochrome complex involved in sulfur oxidation. The SoxAX complex catalyzes the formation of a heterodisulfide bond between the conserved cysteine residue on a sulfur carrier SoxYZ complex subunit SoxY and thiosulfate or other inorganic sulfur substrates. This leads to the liberation of two electrons, which may be transferred from the SoxAX complex to another cytochrome c and which then may be used for reductive CO(2) fixation"
        ],
        "length": 286,
        "sequence": "MKKTIQRGLFTGALVLLTAMTSKPAHAAVNYQALVDADVKKFQGYFLKEFPGVKLEDFGDGVYALDEDSRKQWKEMEEFPPYELDVEAGKALFNKPFANGKSLGSCFSNGGAVRGMYPYFDEKRKEVITLEMAINECRVANGEKPYAPKKGDIARVSAYIASISRGQKIDVKVKSKAAYDAYMKGKEMFYAKRGQLNMSCSGCHMEYSGRHLRAEIISPALGHTTHFPVFRSKWGEIGTLHRRYAGCNENIGAKPFPAQSKEYRDLEFFQTVMSNGLKFNGPASRK",
        "proteome": "UP000308271",
        "gene": "soxA",
        "go_terms": [
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016669",
                "name": "oxidoreductase activity, acting on a sulfur group of donors, cytochrome as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019417",
                "name": "sulfur oxidation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0070069",
                "name": "cytochrome complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4f3d11949f2e95fcca60c21ba1fe5dc599613e41",
        "counters": {
            "domain_architectures": 884,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 884
        }
    }
}