General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A5B9MZ19",
        "id": "A0A5B9MZ19_9CAUD",
        "source_organism": {
            "taxId": "2591060",
            "scientificName": "Shigella phage JK36",
            "fullName": "Shigella phage JK36"
        },
        "name": "Baseplate central spike protein",
        "description": [
            "[Baseplate central spike protein]: Baseplate central spike complex-associated lysozyme that is essential for the localized hydrolysis of bacterial cell wall, so that the tail tube, through which the phage DNA is ejected, can penetrate to the host inner membrane. The tail lysozyme complex at the tip of the tail tube penetrates through the outer membrane into the periplasm. This way, lysozyme domain is released and locally digests the peptidoglycan layer to make a hole to let the tube penetrate to the inner membrane. Involved in the tail assembly"
        ],
        "length": 577,
        "sequence": "MEMISSSLNWFVGVVEDRMDPLKQGRVRVRVVGLHPAQRAQGDVQGIPTEKLPWMTVIQPITSASMSGIGGSVTGPVEGTRVYGHFLDKWKTNGIVLGTYGGIVREKPNRLEGFSDPTGQYPRRLGNDTNVLNQGGEAGYYSNSNVIQDNNLDYGINPDDTDLANIPEDDDPNFTITEMLRRDEGLRDKVYWDHLGYPTVGIGHLIVMEKTRDMSRINKLLSDQVGREVTGNPGTITLEEATALFEKDLAKMQKDIRSNSKVGPVYAKMNRSRQMALENMCFQMGVGGVAKFNTMLKAMAEGDWKTAYKSGRDSLWFQQTKGRASRVTTIILTGNMESYGVPVKTPPSPGVGADLVTRNTDPEDPAGPPVPLDSRILFKEPESSYRGEYPYVHAMETESGHIQEFDDTPGNERYRLVHPTGSYEEVSPSGRRTRKTVEDLFDITNGDGNFLISGDKLVNVGANEIYYNMADRLHQIDGNDTIFIRGNQSKTVEGDGTLYVKGNIKIVVDGNADILVKGDAKTQVEGNHDYTVNGNVKWTVNGNVDMTVAGDWAETMSTMSSVASGQYTVDGSRIDIG",
        "proteome": null,
        "gene": "JK36_00158",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003796",
                "name": "lysozyme activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009253",
                "name": "peptidoglycan catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016998",
                "name": "cell wall macromolecule catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0098932",
                "name": "symbiont entry into host cell via disruption of host cell wall peptidoglycan",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0098025",
                "name": "virus tail, baseplate",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "b787a3ac02c8f1b3eb9c2580134574029c7082e2",
        "counters": {
            "domain_architectures": 141,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "pfam": 3,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 8
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 141
        }
    }
}