GET /api/protein/UniProt/A0A5B9D772/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A5B9D772",
"id": "A0A5B9D772_9ARCH",
"source_organism": {
"taxId": "2594042",
"scientificName": "Promethearchaeum syntrophicum",
"fullName": "Promethearchaeum syntrophicum"
},
"name": "Protein-L-isoaspartate O-methyltransferase",
"description": [
"Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins"
],
"length": 221,
"sequence": "MKNHKINQERLDLINNLKARKIIITENVYNAMLNVPRHLFLPELDINKAYIDSPQQIGKGQTISAPHMNAMMCEYLEIKPKDKILEIGTGSGYHAAILAELTGKGGIVYTIERIPDLAIKAQKKLEELSYSNVEVIIDDGTLGLESKAPFDKILVTAASPKIPKSLLVQLNPNGGILCIPVGKRHWDQDLIVIQRTKEKYIKKKVCKVIFVPLIGENGFDE",
"proteome": "UP000321408",
"gene": "pcm",
"go_terms": [
{
"identifier": "GO:0004719",
"name": "protein-L-isoaspartate (D-aspartate) O-methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0036211",
"name": "protein modification process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "fd27f5d219e6daeaeb97fa24181997eac1119678",
"counters": {
"domain_architectures": 36346,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 36346
}
}
}