General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A5B8QU34",
        "id": "A0A5B8QU34_9GAMM",
        "source_organism": {
            "taxId": "256839",
            "scientificName": "Shewanella decolorationis",
            "fullName": "Shewanella decolorationis"
        },
        "name": "DNA-directed RNA polymerase subunit omega",
        "description": [
            "Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits"
        ],
        "length": 92,
        "sequence": "MARVTVEDAVEQIGNRFDMILVAARRARQIAVQGKDPMVEEMNDKPTVIALREIELGLVNAHTLDADERQTVREREAAEIAAVAAIAEGRSL",
        "proteome": null,
        "gene": "rpoZ",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003899",
                "name": "DNA-directed RNA polymerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006351",
                "name": "DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e86b40bc3674d898b799b1be30e5ef4e4a4b7a40",
        "counters": {
            "domain_architectures": 27502,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 27502
        }
    }
}