HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A559L0Z0",
"id": "A0A559L0Z0_FUSOC",
"source_organism": {
"taxId": "61366",
"scientificName": "Fusarium oxysporum f. sp. cubense",
"fullName": "Fusarium oxysporum f. sp. cubense"
},
"name": "Transcriptional coactivator p15 (PC4) C-terminal domain-containing protein",
"description": null,
"length": 148,
"sequence": "MARTSAAKKRAADSDSEPETVSKRVKSGTSVESDGKDDDGNPYWELSNKRRVGVSDFSKKTFVNIREYYDKDGKTLPGKKGISLSIEQYNAFLKAVPHINAALRAKGLVVEGDIADKPDTALIPAAKVKKERKKSPKANIETTSEEED",
"proteome": null,
"gene": "Focb16_v010798",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003713",
"name": "transcription coactivator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0060261",
"name": "positive regulation of transcription initiation by RNA polymerase II",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9b85e30ad89e14bb238835dae5c72c8ea5bae968",
"counters": {
"domain_architectures": 7976,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 7976
}
}
}