General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A552LF98",
        "id": "A0A552LF98_9CHRO",
        "source_organism": {
            "taxId": "2486237",
            "scientificName": "Microcystis flos-aquae Mf_WU_F_19750830_S460",
            "fullName": "Microcystis flos-aquae Mf_WU_F_19750830_S460"
        },
        "name": "Cytochrome b6-f complex subunit 7",
        "description": [
            "Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions"
        ],
        "length": 37,
        "sequence": "MTAESMLFNGPIVAIVLVLVGLAWGFLLLKIQGGEAE",
        "proteome": null,
        "gene": "petM",
        "go_terms": [
            {
                "identifier": "GO:0009512",
                "name": "cytochrome b6f complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b027d5f887b3f82938f80885b924737dd53de9a9",
        "counters": {
            "domain_architectures": 1428,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1428
        }
    }
}