General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A518CQE9",
        "id": "A0A518CQE9_9PLAN",
        "source_organism": {
            "taxId": "2528007",
            "scientificName": "Polystyrenella longa",
            "fullName": "Polystyrenella longa"
        },
        "name": "Formylmethanofuran--tetrahydromethanopterin formyltransferase",
        "description": [
            "Catalyzes the transfer of a formyl group from 5-formyl tetrahydromethanopterin (5-formyl-H(4)MPT) to methanofuran (MFR) to produce formylmethanofuran (formyl-MFR) and tetrahydromethanopterin (H(4)MPT)"
        ],
        "length": 302,
        "sequence": "METFLCHKTNVADTFAEAFPVVGTRILITADSNYWAEQAGREVTGHATSVIACDVEASIERALAESESPDGRPGVSVLMFAFDRKSLQKAIVNRVGQNVLTCPTTACYNGITDYDPEKAISLGGQLRFFGDGFQSSKKLGDRRFWRIPVMDGEFLCDEQVGTCKGVGGGNLILCGESNSSVLHAAETAVAAIRKLTDIALPFPGGIVRSGSKVGSKYSGLKASTNEAYCPTLTSRVETELPEGTNSVLEIVMDGLSYKAITQGMQAGINAAAVCDGLTLITAGNYGGKLGPHLFHLRELVGV",
        "proteome": "UP000317178",
        "gene": "fhcD_2",
        "go_terms": [
            {
                "identifier": "GO:0016740",
                "name": "transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006730",
                "name": "one-carbon metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030270",
                "name": "formylmethanofuran-tetrahydromethanopterin N-formyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bdc9b4685b884b63688dfd184173cf42c2bde1ca",
        "counters": {
            "domain_architectures": 1160,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 2,
                "cathgene3d": 1,
                "hamap": 1,
                "ncbifam": 2,
                "pirsf": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1160
        }
    }
}