GET /api/protein/UniProt/A0A518CQE9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A518CQE9",
"id": "A0A518CQE9_9PLAN",
"source_organism": {
"taxId": "2528007",
"scientificName": "Polystyrenella longa",
"fullName": "Polystyrenella longa"
},
"name": "Formylmethanofuran--tetrahydromethanopterin formyltransferase",
"description": [
"Catalyzes the transfer of a formyl group from 5-formyl tetrahydromethanopterin (5-formyl-H(4)MPT) to methanofuran (MFR) to produce formylmethanofuran (formyl-MFR) and tetrahydromethanopterin (H(4)MPT)"
],
"length": 302,
"sequence": "METFLCHKTNVADTFAEAFPVVGTRILITADSNYWAEQAGREVTGHATSVIACDVEASIERALAESESPDGRPGVSVLMFAFDRKSLQKAIVNRVGQNVLTCPTTACYNGITDYDPEKAISLGGQLRFFGDGFQSSKKLGDRRFWRIPVMDGEFLCDEQVGTCKGVGGGNLILCGESNSSVLHAAETAVAAIRKLTDIALPFPGGIVRSGSKVGSKYSGLKASTNEAYCPTLTSRVETELPEGTNSVLEIVMDGLSYKAITQGMQAGINAAAVCDGLTLITAGNYGGKLGPHLFHLRELVGV",
"proteome": "UP000317178",
"gene": "fhcD_2",
"go_terms": [
{
"identifier": "GO:0016740",
"name": "transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006730",
"name": "one-carbon metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030270",
"name": "formylmethanofuran-tetrahydromethanopterin N-formyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bdc9b4685b884b63688dfd184173cf42c2bde1ca",
"counters": {
"domain_architectures": 1160,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 2,
"cathgene3d": 1,
"hamap": 1,
"ncbifam": 2,
"pirsf": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1160
}
}
}