General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A516RTP7",
        "id": "A0A516RTP7_9HEPA",
        "source_organism": {
            "taxId": "2596879",
            "scientificName": "Crowned shrew hepatitis B virus",
            "fullName": "Crowned shrew hepatitis B virus"
        },
        "name": "Protein X",
        "description": [
            "Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with host factors"
        ],
        "length": 135,
        "sequence": "MAARMLYDLDPATGTLRLRAIQSQPGGLSFSPVGPSPRTAPSPSSLSGPGSHRSLRGLPSCFASSAGPCVLRFTFGELGQLDQPRNAVLSIQARSRGTELRASQQRNWTWYMLCNPNVNNLGHDWLMYYGGCRHK",
        "proteome": null,
        "gene": "X",
        "go_terms": [
            {
                "identifier": "GO:0019079",
                "name": "viral genome replication",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "081766d53e85ec9d070716190b21b776cf49b734",
        "counters": {
            "domain_architectures": 14317,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 14317
        }
    }
}