GET /api/protein/UniProt/A0A516II86/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A516II86",
"id": "A0A516II86_SALET",
"source_organism": {
"taxId": "149384",
"scientificName": "Salmonella enterica subsp. enterica serovar Wien",
"fullName": "Salmonella enterica subsp. enterica serovar Wien"
},
"name": "tRNA(fMet)-specific endonuclease VapC",
"description": [
"Toxic component of a toxin-antitoxin (TA) system. A site-specific tRNA-(fMet) endonuclease, it cleaves both charged and uncharged tRNA-(fMet) between positions 38 and 39 at the anticodon stem-loop boundary. Its toxic effects are neutralized by expression of cognate antitoxin VapB"
],
"length": 138,
"sequence": "MNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRAAVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR",
"proteome": null,
"gene": "vapC_2",
"go_terms": [
{
"identifier": "GO:0004540",
"name": "RNA nuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "efa7cc22836035cd52b011ac128df8b7783ede4e",
"counters": {
"domain_architectures": 62123,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"hamap": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 62123
}
}
}